PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG765600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bHLH
Protein Properties Length: 248aa    MW: 27250.7 Da    PI: 6.1625
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG765600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH45.31.5e-1474126155
                          CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                  HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                          r+ +hn+ Er RR+++N+ ++ Lr+llP a   + kKls  +++ ++ +YI +Lq
  Pavir.5KG765600.2.p  74 RKLSHNAYERDRRKQLNELYSSLRSLLPDA--DHTKKLSIPTTVSRVLKYIPELQ 126
                          6889*************************7..35666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.7E-1670141IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000833.68E-1173129No hitNo description
PROSITE profilePS5088814.20873125IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.0E-1174126IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.109.1E-1374141IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003535.1E-1079131IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MEHQLFDDPF SSSISSLEAD IFSAGGQLPS PLWPDLELDL DLDDEDIHDL SAPAANATSS  60
GGYGSGGGSG GSHRKLSHNA YERDRRKQLN ELYSSLRSLL PDADHTKKLS IPTTVSRVLK  120
YIPELQKQVD NLERRKKELT NANCKPGVLK TSQIVTPIVS ATCLNDTEIM VQVSLQSNVA  180
ATSLPLSKCI KVLENEGLHL ISSSTYSTFD NRTFYSLHLQ RSQRTMKEEC PAFCDELERI  240
IKKKAGA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.34520.0callus| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971295.11e-144PREDICTED: transcription factor ORG3-like
TrEMBLK3XLE71e-144K3XLE7_SETIT; Uncharacterized protein
STRINGSi002720m1e-143(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04150.13e-31bHLH family protein